PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00281-snap-gene-0.36-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 168aa    MW: 19267.8 Da    PI: 10.4443
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00281-snap-gene-0.36-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1062e-3389147159
                                                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                ldDgy+WrKYGqK vk+s+fprsYYrCt++gC+vkk+++r ++d++vv++tYeg H h+
  maker-scaffold00281-snap-gene-0.36-mRNA-1  89 LDDGYRWRKYGQKAVKNSKFPRSYYRCTHKGCNVKKQIQRLSKDEEVVVTTYEGMHSHP 147
                                                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-3374147IPR003657WRKY domain
SuperFamilySSF1182905.1E-2981148IPR003657WRKY domain
PROSITE profilePS5081129.88484149IPR003657WRKY domain
SMARTSM007741.6E-3889148IPR003657WRKY domain
PfamPF031066.5E-2790147IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MAPMQNNQML LLGSSSSSAV STSSLNIENF NSQNFFHGAN KKDKMKVETR IQHHEANNIS  60
EGGGKVTKGD KKIRRHRFAF HTRSHVDILD DGYRWRKYGQ KAVKNSKFPR SYYRCTHKGC  120
NVKKQIQRLS KDEEVVVTTY EGMHSHPLEK TTDSFEQILK QLQTPAPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-2779148776Probable WRKY transcription factor 4
2lex_A1e-2779148776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001268218.15e-62WRKY-type DNA binding protein 1
SwissprotQ9FYA21e-50WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLQ5IZC75e-62Q5IZC7_VITVI; WRKY-type DNA binding protein 1
STRINGVIT_17s0000g01280.t012e-61(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.13e-51WRKY DNA-binding protein 75